PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00039251-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 492aa    MW: 55532.3 Da    PI: 4.6261
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00039251-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS36.47.5e-12293338146
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayft 46 
                       l+ lL++cA+av++++++ a+ +L++++ +as +gd +qRla yf+
  PSME_00039251-RA 293 LRALLVHCAQAVATDNTRGANDILKQIRRHASAYGDGTQRLANYFA 338
                       5789*****************************************7 PP

2GRAS156.32.7e-4834048476219
              GRAS  76 eelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLa 166
                       e l+a++lf  + P++k+  l++Nq++l+ +e+++r+Hi+Df+i +G+QWp+L+q La+Rp+gpp+lRiTg++ p++g   +e++eetg+rLa
  PSME_00039251-RA 340 EILKAYQLFIVAIPYVKIYRLLTNQTVLNVTEKSNRLHIVDFGILYGFQWPSLIQRLANRPGGPPMLRITGIDFPQPGfrVAERIEETGRRLA 432
                       7789*************************************************************************9*99************ PP

              GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvs 219
                       ++A+++gvpfe+++ +a ++e+l++ee++++++E+l+Vn++++  +llde+v 
  PSME_00039251-RA 433 NYAKSFGVPFEYHA-IAAEWENLDVEEISLRNDEVLVVNCMYRFNNLLDETVV 484
                       **************.799******************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.459267492IPR005202Transcription factor GRAS
PfamPF035142.6E-9293338IPR005202Transcription factor GRAS
PfamPF035149.2E-46340484IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MADEKTGIFY SNDINRVSNN IGLQQETAMP ATQFRGSLSS EKSITISEWE SEDTELYSDI  60
VLKYINDMLM DENMEEKNVI YQECSSLQAT VKPFNDILGE NYPPQGLCNS NTVGENQKQS  120
LNYYEDDVQN KIEDNCWIGE FFNSQMQRGF ESTLSVNLSA GYSSQQGLGV GEFEEAIQVG  180
KREAAIGVPF QMNAAHSDDE NEPKCQKDPH RGDLDLEDRE SNKLSAVYQD NVIRTESFDK  240
VLLCNENGRV FLDWKLETLQ NGVQKSVQSG SVKGLQGSKT RGMKQGKREV VDLRALLVHC  300
AQAVATDNTR GANDILKQIR RHASAYGDGT QRLANYFADE ILKAYQLFIV AIPYVKIYRL  360
LTNQTVLNVT EKSNRLHIVD FGILYGFQWP SLIQRLANRP GGPPMLRITG IDFPQPGFRV  420
AERIEETGRR LANYAKSFGV PFEYHAIAAE WENLDVEEIS LRNDEVLVVN CMYRFNNLLD  480
ETVVLGALKI SC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-272974828218GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429104.11e-122hypothetical protein CICLE_v10011141mg
RefseqXP_006429105.11e-122hypothetical protein CICLE_v10011141mg
RefseqXP_006480839.11e-122PREDICTED: scarecrow-like protein 9
RefseqXP_008799752.11e-122PREDICTED: scarecrow-like protein 9
RefseqXP_008799758.11e-122PREDICTED: scarecrow-like protein 9
TrEMBLA3E2G20.0A3E2G2_PINRA; SCARECROW-like protein 1
STRINGVIT_08s0007g00510.t011e-123(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.12e-88GRAS family protein